DPCstruct | MC7519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 255 ± 64 aa |
| Standard deviation of domain lengths | 64.01 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 58.64 |
| Assigned Pfam label(s) | CL0425- PF20501- PF06455- PF13244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3E4D7 | 1-182 | MIHLIAMLMILAVFSIFFGFITKDMFIGLGSGFFSDNALFIHPSHEIMLDTEFAVPTLFKLLPLVFTISLSVISIVLSEYLSTILMY… |
| A0A2B7ZZL0 | 22-249 | LSRVFSHSPTVWLILQASSLITVFYMFRLLYLVFFNDFRGSDRVREHIHESPPVITIPLVILATLAAAAGLLGLPSLLGKNWIEGWL… |
| A0A1F9PGL4 | 8-157 | None |
| A0A3M1DYT1 | 87-330 | None |
| A0A3A0CF36 | 509-782 | None |
| A0A1D1YTC3 | 45-308 | None |
| A0A090MKD2 | 5-193 | None |
| A0A6L5F1S3 | 7-195 | None |
| A0A832WW70 | 11-277 | None |
| A0A656BKA2 | 9-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.