DPCstruct | MC7512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 310 ± 64 aa |
| Standard deviation of domain lengths | 64.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8LH53 | 22-283 | AEREAIAAAATAGALRRRNQGNDPTQMARRIAAALNVGIWDFGFYWITAVTNDGTIVVANSYGIGYIPEKVFLPDNVRMATADESIT… |
| A0A138AJT4 | 29-345 | QQASPSTGAQTPGSTVVAAGEGTRRAVAGAKASQGPSREGKMAEQLCLELVAAAPAALLDWAVAVFRPSEDAQPVLLVTSNMGPSYI… |
| A0A246BR36 | 454-746 | None |
| A0A370HCV5 | 7-296 | None |
| A0A1X1ZTL5 | 3-236 | None |
| A0A653EXN9 | 465-792 | None |
| A0A1A3PAQ0 | 144-488 | None |
| A0A1V3XWG2 | 231-457 | None |
| X8F8F9 | 6-283 | None |
| K0EZ05 | 29-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.