DPCstruct | MC7511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.77 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0123- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6PVG4 | 24-102 | LQKRNVDDIGGLSERILKLLKENSGRLDISDKTPPEKIYSMFGVSKKIYKNAIGSLYKRRLITIDDYSITLCQNRDHDK |
| A0A4Q2WN46 | 6-72 | YNEIENDAQMIMERLKLGGGILSINDNSSPEHIKNELNISKRAFKRAVGRLLKEGAVKITEEGIELT |
| A0A1E7FF71 | 193-281 | None |
| A0A7S1D7J4 | 101-168 | None |
| L1IE22 | 558-626 | None |
| A1HNX5 | 335-407 | None |
| W7TUB5 | 295-365 | None |
| A0A4Q3W4V8 | 239-309 | None |
| A0A4Q3EG39 | 335-397 | None |
| A0A7Y3HN35 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.