DPCstruct | MC7510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 26.64 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8Q1C9 | 12-137 | EHPEAYRIGRGEEGVFHAQPYKGELLPLWSFKTVEAARESADAIHEKFRGYAAEGDFVGMDVARKYLQMGYTRSRRYAMHKGGNKSK… |
| A0A7W1RLD8 | 52-185 | ERYVIGRGEQGVLTVEPYKSELLPLWRFKTPAIARTSARALYRAFLAYGKAQDFVGMDMARKFLQMGWTRARRYANHASGRKYGPGR… |
| A0A2P6NZX7 | 30-206 | None |
| M9ME13 | 32-201 | None |
| A0A4V5N6P3 | 26-171 | None |
| A0A7Z2NGQ2 | 16-159 | None |
| A0A3M7MD14 | 86-257 | None |
| A0A061NN22 | 1-106 | None |
| A0A4R5ARY0 | 3-130 | None |
| I2FX42 | 80-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.