DPCstruct | MC7509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 553 ± 80 aa |
| Standard deviation of domain lengths | 80.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9YNP5 | 189-823 | PLQPESPVVPKRSTCDPLDPAVCMQPWPSNYFTKPAVTPTGLRLDLPLDAMPENVAGRPIDPTDINRADGFSPGNPITLKIPAVDTP… |
| A0A7W1MI21 | 88-647 | WAFTVTTRTELAMDKASQRMPLPINLMLDPKTGHVHVPAAPWDRPFEAAAKSRLSDFTGFGLSASPLFEFTAPMNPTTVTASTVKVY… |
| A0A1Q9GSK3 | 1-513 | None |
| X6M343 | 5-376 | None |
| A0A6L8BDE0 | 38-485 | None |
| A0A6N2D3F5 | 70-676 | None |
| A0A086WLD6 | 38-576 | None |
| A0A7S2UIJ9 | 592-1086 | None |
| A0A5C8A9B9 | 392-1155 | None |
| A0A1Z7ZYV2 | 37-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.