DPCstruct | MC7508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 32.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8MKI1 | 10-193 | YQVRFDWGVAGLSRLAPADLVVVVDVLGAGTAASDAIEAGSPLAHAALDQRFPDAAAVVRAAVDAGSGVLLGSLRTARAVAEAVAAV… |
| A0A7W1AK46 | 8-193 | LDRGAALGAHAILVGEQQGKRLPGFHCNNSPTELAAFDLDGKTVVITTTNGTKAVAACADAHRIFAGALTNAPALGRFLCARGELER… |
| A0A4R1KP87 | 20-214 | None |
| A0A7C2VNG5 | 13-173 | None |
| A0A1V5ZIZ5 | 19-239 | None |
| M9XGL0 | 2-205 | None |
| A0A7C3U072 | 12-234 | None |
| A0A842UXX5 | 2-140 | None |
| A0A2N2MN69 | 23-233 | None |
| A0A350XS17 | 284-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.