DPCstruct | MC7505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0KC18 | 17-105 | FADLEKKAPALVAEMRQDLTKNPLVREFIILSKKVTYMGSGKLIFMYFLEEHENLRGIVDVMLNYGAIFDVSFNKVPRYNFREDFVE… |
| A0A1G5SDY9 | 52-138 | EKLLKEMQQDLRKPEFQFHREFFVEKKGWNWNRLGLHRHGPCLVYFIEDHIDLPQQLDALAREGLVTKVDEKKGQFQFGEKFAEWLR |
| A0A7X4I2V3 | 196-294 | None |
| A0A514WGE7 | 8-96 | None |
| A0A378JWN3 | 43-129 | None |
| A0A7C2QWP5 | 2-83 | None |
| X6K4C9 | 80-167 | None |
| A0A2E9JVE1 | 30-120 | None |
| A0A837X3A7 | 38-139 | None |
| A0A120LUN2 | 123-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.