DPCstruct | MC7504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1GYA3 | 27-85 | PIPPVATLSEQQVCGHVCVWCGAALATGRVVDLGQRQIQRLDCHITMFPRACRACVRVQ |
| A0A1D8G0Q1 | 15-75 | PVPDRARLTGEQRHGTACVWCAVVLSPETAADLGHRPYTTPSVDYVLTWWPRGCRACVAAR |
| A0A7X9Z4H1 | 3-73 | None |
| D9URW5 | 111-168 | None |
| D9UP77 | 90-148 | None |
| G0PPI3 | 1-69 | None |
| A0A2U3H9J9 | 3-54 | None |
| D6M3Z6 | 78-165 | None |
| A0A1H5KYL3 | 115-169 | None |
| A0A0C2B7F8 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.