DPCstruct | MC7502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0Z7L7 | 3-88 | EYFAFFIKAKKQSGQQDMLFCCQADSVRVAYSQLYRALTANALHLDDYFTPRRTPLPIGIKLPAEGKLDRAFCRRYHLVGDRWLKR |
| A0A854JCZ2 | 1-82 | MSKIFICAAIPDEQAIKDEGAVAVATAIEAGDERRARAKFHWQFLEHYPAAQDCAYKFLVCEDKPGIPRPALDSWDAEYMQE |
| A0A763QQV6 | 4-103 | None |
| A0A4U9HEA4 | 1-95 | None |
| F4TGA8 | 1-82 | None |
| A0A376FD10 | 1-95 | None |
| A0A6G3I6S6 | 5-103 | None |
| A0A485CX36 | 2-100 | None |
| A0A022PK38 | 3-93 | None |
| A0A726XV74 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.