DPCstruct | MC7500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q46YQ1 | 34-161 | NPLPPPSACPYCSAKIEIVGNEQIYGRSFGDWPWAYRCTGKNCHAYVGMHPFTNVPLGTLADAPTREARKCAKAVFNPIWQSKRMTR… |
| A0A4D8QTI6 | 7-159 | MPALKCPDCGAPMRLQPTPSTFKTPNPFVYLCDRRAAGCGGLMSAHPDGTPQGAPVAAELRRARRMTHQVFDRLWQTAPHYYPVAET… |
| A0A2S5LA05 | 4-110 | None |
| A0A6I2RLV9 | 71-197 | None |
| A0A077MNX8 | 1-78 | None |
| H8FP24 | 1-137 | None |
| A0A7D5YTF9 | 12-134 | None |
| A0A2T6EY05 | 2-123 | None |
| A0A316RF84 | 13-123 | None |
| A0A373DBL5 | 39-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.