DPCstruct | MC750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 471 ± 29 aa |
| Standard deviation of domain lengths | 28.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8S0M8 | 1-459 | MRLQLPRGFELDVHFRQPDFNMIWKIVEYSRKVEASFKPEAGEKLIFEEVLDVFQYMDPRPSKAFPPEPSPRCRIRLFEKTVKITEG… |
| A0A0G2IAW2 | 61-509 | EVKLPRGFALATQCRSQDFKVLWGMQDFNAKSLATLQPRKEEEIVFKSTLRSFQYFDSNAQSATFPREAVRACDIGLFEKILKESSP… |
| A0A254TS98 | 96-575 | None |
| A0A395IQ38 | 1-405 | None |
| A0A420HHY3 | 543-1040 | None |
| A0A5N6WF29 | 544-1024 | None |
| A0A1B8EU79 | 622-1098 | None |
| A0A370TE17 | 317-832 | None |
| A0A4Q4NJW1 | 542-990 | None |
| A0A5M8PPF2 | 486-978 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.