DPCstruct | MC75
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1UKM3 | 95-217 | PRVAHTTGDLDVHDLAVDRAGRPVFVNTLFSCLATLAPRASFAPLWRPPFVSRLAAEDRCHLNGLAMAEGSPAFVTAVARSDVADGW… |
| A0A3D2TJX5 | 1-101 | MAWAGDQLWFVNTAFSCLGTRFEGNSIDPRWRPSFVKDLGPGDKCHLNSLALRDGRVRYVTALGETDTVGGWRENKRDGGLLMDVEN… |
| B5IQK8 | 362-471 | None |
| A0A8A5Z4R7 | 76-174 | None |
| A0A182ASK6 | 105-214 | None |
| A0A7Y5SLG2 | 7-103 | None |
| A0A2H2YVX9 | 72-175 | None |
| I4W1H2 | 72-169 | None |
| A0A1H6Y7K0 | 44-160 | None |
| K9YEI6 | 89-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.