DPCstruct | MC7497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418WL37 | 1-56 | MVVCVCNAIREKDLRETVRSGGGRNACSAYAALGRRTRCGQCIPFAQSIIKSELAT |
| B3QFV4 | 1-66 | MIVCSCNVLSDHDVRATMHSEGGPARNPGEVHRCLGCSRKCGRCMHTIKNIMNEALCGAAERRAGS |
| A0A4P7F513 | 1-79 | None |
| A0A5E8VN24 | 1-90 | None |
| A0A1H5H6T7 | 39-123 | None |
| A0A4Q1VXY5 | 1-84 | None |
| A0A4Q1V7V1 | 1-64 | None |
| A0A7W7Z5J7 | 1-75 | None |
| A0A1G5KV08 | 28-112 | None |
| A0A4Q9VV62 | 5-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.