DPCstruct | MC7496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3QCK0 | 1-72 | MTDKPDGKAADGQALHALKRDAERYRWLRERDVETIDMGGVFVGKTPENVVLNGIDCDAAVDAARIAEQEPD |
| A0A7W7Z2C9 | 44-105 | ATLAAHAPAAAADTRDAVRYRWLRSRDVGTIYDGGVFVGKTPGNLVLSGIHLDAAVDAARIA |
| A0A014NY49 | 152-218 | None |
| A0A6B0DMV5 | 156-221 | None |
| A0A6N9T2D9 | 38-104 | None |
| A0A2A2KA85 | 87-145 | None |
| A0A7V8GXT9 | 22-98 | None |
| A0A136QN29 | 41-101 | None |
| A0A1Y5TLX1 | 25-86 | None |
| A0A0H4KU53 | 55-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.