DPCstruct | MC7493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A411E9P3 | 1-138 | MELVRIERLLEKYFEAQTTRAEEKELKEYFSGEQVELHLEQYRPMFTYFSSAKQERFTQQVPLKPRTNLYKWISVAAVVVMVAGIFF… |
| A0A7Y1V2R1 | 1-155 | METDNIKILLDKYWAGESSMEEERSLKEYFSNDQVDPAFEAIRPLFAFYKQQGEITMASEINHKPRVEPVARIHNLRWLINVAATVL… |
| A0A3N0ZV95 | 1-177 | None |
| R5WRM7 | 2-186 | None |
| A0A2E6PT32 | 1-121 | None |
| A0A1F3LEL2 | 19-175 | None |
| A0A1M4T690 | 1-171 | None |
| A0A3D5ZBR0 | 1-168 | None |
| A0A7Y7DH41 | 1-137 | None |
| A0A2L2WQN7 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.