DPCstruct | MC7492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 160 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R4HC96 | 8-196 | TPKKDRLTVLSVLTNFTPVQYLYNQQAQTLLDTFKLTDKSRVAIDAQLPADTVMNEAEFAVQLACLNGLGVRQVTHLTEACAIAYYQ… |
| A0A0B6VJM7 | 155-315 | RQQKLPRELLGKVALKSNESMNEKPWQEWLASLAISRRKHQQTVIEGALLGALLERDEIRHLAVVSDGAPQFSVLQHGLCWVHAERQ… |
| A0A7V2WU33 | 56-235 | None |
| A0A849T6C9 | 27-189 | None |
| I4FXH8 | 7-134 | None |
| A0A5P8WD63 | 6-129 | None |
| A0A1E7G891 | 115-282 | None |
| A0A1E7GA00 | 38-203 | None |
| E1I9L8 | 25-161 | None |
| C4RAH5 | 76-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.