DPCstruct | MC7490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 250 ± 50 aa |
| Standard deviation of domain lengths | 50.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R4H8G3 | 15-372 | TNSDNNDYIDARKIKYVQFDLTQPYANYNWEVFYHLPIATAAFLSSQHRFEEARQWFHFIFDPTTNDSNSGRERFWRFLPFRNAQIP… |
| A0A2S8R393 | 355-589 | VPTFTEPMDFSGSNSLYFWELFYYVPMLIAQRLLHEQNFDEANRWLKYIWNPSGYIENGQIQHYNWNVRPLLEDTRWNDDPLNSVDP… |
| A0A084R3G8 | 641-793 | None |
| A0A849EWZ7 | 170-490 | None |
| X7YBI6 | 813-1083 | None |
| A0A4Q1BEG8 | 1-155 | None |
| A0A0L0LZZ7 | 607-838 | None |
| A0A6A7ZDS0 | 575-805 | None |
| A0A0C2CZK5 | 1-235 | None |
| A0A0L0JGV6 | 2-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.