DPCstruct | MC7487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0R0X2 | 94-199 | YLDDTELATYLSLGDYGDRRGLYTPSFWGNNSSQYGMLVNIRIDNAGTFINGEKAGATTIGDLHLDGKFVTHLKIAVKDDAKYVGGI… |
| A0A7X3A5N4 | 22-126 | YFNGKKVGMWTSPGDFGGKGKLNPPWWFESVSQYGLLKHLIIKKDGTFMDGIQLSDVSIDDIDIRSNQWTFRIAVEADAEHIGGVTL… |
| A0A6A7K9B8 | 204-314 | None |
| A0A416MI52 | 1-110 | None |
| A0A4Q3USD5 | 92-197 | None |
| V9GFE3 | 134-238 | None |
| A0A6L5X4Y8 | 216-325 | None |
| A0A7Y1U2K0 | 54-160 | None |
| A0A143YQF7 | 83-182 | None |
| A0A0B0I9G2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.