DPCstruct | MC7485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 306 ± 42 aa |
| Standard deviation of domain lengths | 42.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5YAC4 | 65-369 | NTFSFFPKVQNLEVTFMSERDLIRCNDDDFEIRWDEVRKFWNVLQERFPSVKHVVLNHSHESPERFRDDHSVSIALRALMRTCPQSL… |
| A0A177C2E3 | 35-292 | VSRVKKVILNHNGESGRWEDDKEPFAYVLQLLLWSCPPDIKASALYKTKQKSRQPVYATKTPSRLWRRVSFALAADGEWEEREPELS… |
| A0A6A5VSY3 | 7-270 | None |
| A0A6A6U1C9 | 94-468 | None |
| A0A1L7XJL3 | 305-530 | None |
| A0A177DCG0 | 127-442 | None |
| A0A177CTF3 | 191-510 | None |
| A0A6A5RMV2 | 1-313 | None |
| A0A1Y1YJM9 | 1-349 | None |
| A0A1S9RXN1 | 181-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.