DPCstruct | MC7484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5X4Y1 | 73-175 | TTPPAAIVQETPDISMIDAPASPITDHHTVPPQVAEAKVSPEEEDFASIYLRKITGELADDLDKVRGANDFTARSMPMLVHALRQGV… |
| A0A177BWB3 | 1-100 | MTDAHDAPSSHSPASASTSPAPPSAPTTLPAKSKVLPKDPEEFSAIYLKKITSELADDLVKVRDAQDFKDSSLKMLIHALKQGSSIY… |
| A0A6A6U456 | 1-116 | None |
| A0A6A5ZS69 | 46-155 | None |
| E5A3V5 | 104-211 | None |
| A0A2T0FBU6 | 25-135 | None |
| A0A3M7E7F3 | 24-136 | None |
| A0A436ZPD7 | 108-227 | None |
| A0A2J6RV61 | 8-117 | None |
| A0A642V708 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.