DPCstruct | MC7482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4VGQ6 | 3-103 | NFDWLLQGFAEAATPTNLLYAVIGVLLGTAVGVLPGIGPAMTVALLLPITYNVSPSAAFIMFAGIFYGGMYGGSTTSILLNTPGESS… |
| A0A5D0RSL0 | 16-96 | FSHLMNGFLILGSDPVGLLWIALGVLVGIVTGAIPGLTATMGVAVFIPITFSLEPQIALGTLIGVYCGGLSGGAVPAILLN |
| A0A0K2QWV6 | 1-91 | None |
| A0A0B8PIH0 | 7-77 | None |
| A0A829W7J3 | 1-80 | None |
| A0A395YH52 | 29-107 | None |
| A0A7V2XA30 | 3-83 | None |
| A0A090SQ71 | 1-81 | None |
| A0A268HXU7 | 2-84 | None |
| I5C682 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.