DPCstruct | MC7481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 64.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5PUG9 | 4-56 | QIHTYTELRQQIHDDLRIQHPEWVKSNGECPTCDSYESRLTEMLGALTQARGT |
| A0A2V5SYN6 | 3-61 | VSHQIHTYTELRQQIHDDLRIQHPEWVQPNGESPTCDSYEARLMELLDPLTRRGSNESI |
| A0A2V6E0J3 | 14-74 | None |
| A0A2V6A8K9 | 5-62 | None |
| A0A2V6DQG0 | 6-68 | None |
| A0A2V5RYZ4 | 3-58 | None |
| A0A2V6BD05 | 18-76 | None |
| A0A2V5QV07 | 123-183 | None |
| A0A2V5QRS8 | 56-120 | None |
| A0A2V6IIZ5 | 27-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.