DPCstruct | MC748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 231 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KTA4 | 193-440 | MDGVFVTYHNTARIFGFQYVPLEEMDQRLYGNSNVGQVVFERCLHLLEIINSEVIKHFPGKTVSCLWDSVPKNGMLRVWVEPIDSKQ… |
| A0A0J8RY21 | 1-252 | MDGIFVAFHNTQRIFGFQYLALPEMDRALHGQEDVALGDAEFVHSITLWNKVLNAATAQFPEQSLRFHFETRDGVVPFMYIFAEPVT… |
| A0A1R1XBA9 | 241-467 | None |
| A0A2G5B603 | 190-443 | None |
| A0A2T9YDC0 | 315-559 | None |
| A0A2H9TPE6 | 361-544 | None |
| A0A1R1PIP7 | 1-208 | None |
| A0A1R1Y3I7 | 116-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.