DPCstruct | MC7478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 221 |
|---|---|
| Mean domain length (aa) | 138 ± 21 aa |
| Standard deviation of domain lengths | 20.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2QWP1 | 3-108 | QLITTELVELDQNLGTSPEDVIRHLASKVAATGRASEVEGLFADAFGREQKTATGIPGGIAIPHCRSAAVIEPTLAMARLNPKVDFG… |
| A0A2V5S8I0 | 6-135 | RWAAIVELIDLLVRLGKIKPADRDPILTALRQREETMSTGIGFGIAIPHCSSDRLDEVVAAFGRSTNGIEFDALDNAPVQFVVLFIV… |
| A0A538QR74 | 8-156 | None |
| A0A2N5E221 | 367-510 | None |
| A0A6N3EUK4 | 509-651 | None |
| A0A6I9Q5V5 | 4-126 | None |
| F5NQS7 | 8-151 | None |
| A0A3M1VA37 | 103-262 | None |
| A0A1H9QM71 | 148-302 | None |
| A0A6J4WPY6 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.