DPCstruct | MC7475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4D917 | 7-120 | IYLQLHKLSTIKSQEDLQHILSTLWNTRKTGLSAPDKSSLRSLLNLPSSAELDPVLACLRSLIRKCVNENFTGDDILKLFPPDLPLD… |
| A0A328D942 | 6-120 | VWEHLPLLVRANSKESVEYIFQALWRTRKTGLDAADRRLFQEMLNLPGSDSDLDPLLVCLRILIRRCVFEGVKKDEIQMLFPDGVLP… |
| A0A7J0GF07 | 1-120 | None |
| A0A5J9T260 | 4-123 | None |
| A0A7J7L1L2 | 3-123 | None |
| A0A835INN8 | 1-109 | None |
| A0A830CLY5 | 4-121 | None |
| A0A7J8UUR0 | 24-134 | None |
| A0A834SCG3 | 59-174 | None |
| A0A287WJA7 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.