DPCstruct | MC7474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9QMP2 | 4-117 | AAVDAARNGLLEVAGEHEVGEHVGAFPDAERLVTHRFAAHVPGYEGWHWFATLARVPRGKDATVCEVGLLPSENALLAPDWVPWSER… |
| U1MTN6 | 90-196 | TPTVPTMQELELALSALDDVAPKGAVGEVQDALGEGDHVVAIRHASRLPGYPDWSWTVLLSRGIEGGPTVLEVALLPGEGSLLAPAW… |
| A0A1S1CMP0 | 113-242 | None |
| A0A7K1ARZ5 | 1-97 | None |
| A0A7X8YDZ5 | 1-102 | None |
| A0A126YZ25 | 2-114 | None |
| A0A358SPW2 | 69-200 | None |
| A0A318AJX3 | 31-140 | None |
| A0A2G6JUR8 | 1-99 | None |
| A0A199NWI1 | 5-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.