DPCstruct | MC7472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 188 ± 29 aa |
| Standard deviation of domain lengths | 29.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 51.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4NFS1 | 1-170 | MSVGYQIGEAAQKVKNTKAIQNLADRYDRLNNLLTQHNYLNLLVAQANTPSAITGAINNLSTSATNLTNGTTTSLAYQAVSLALNTA… |
| I9TTW5 | 3-165 | KNTKGIQQLSENYEKLNNFLNNYNTLNTLVKLSSDPSAVNDARDNLGSSAKNLLDVKANSPAYQAVLLALNAAVGLWQVTSYAFTAC… |
| E1SA26 | 1-229 | None |
| J0P4T7 | 1-151 | None |
| J0L0U6 | 1-226 | None |
| A0A496GQZ3 | 30-217 | None |
| A0A1Q2RQW9 | 1-215 | None |
| K8GTJ3 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.