DPCstruct | MC7470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D8G4X5 | 7-126 | RTCPAKGAQAASPRPPWAVGTLVAAGLLLTGAALLHLGMVFFSLAPHNAVTARHRAAVDAYVQPEFGQDWKLFAPNPLQRDEAVGVR… |
| A0A6C0Q495 | 29-175 | HTADGAGSTGVRETDPTGVPATSRVLKAGLRTVVLLCLATVLAHAALVFLHVAPSNAVSQRYARQINAWVYPLFEQNWRLFAPDPDS… |
| D1H0L1 | 79-213 | None |
| A0A6L8N102 | 38-170 | None |
| A0A6M4PLV9 | 20-154 | None |
| A0A6H9V3M3 | 137-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.