DPCstruct | MC747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LJU7 | 1-63 | MKVLAILYDGFKAAQQEPRLLGTVENRLGLSEWLKARGHEFIVSSSKEGPDSDFQKHIEDAEV |
| A0A0J8RWW5 | 3-64 | KVLMVMYDGGEHAKQQPGLLGTTENELGLRKWLEERGHTLVTTSDKEGSNSTFERELVDAEI |
| A0A7J6VQC7 | 432-487 | None |
| E2LG62 | 1-62 | None |
| A0A565BAN8 | 36-97 | None |
| J4I9G7 | 287-349 | None |
| A0A383WFJ4 | 52-112 | None |
| W2PTM2 | 1-63 | None |
| A0A368PQI9 | 30-90 | None |
| A0A287UKP4 | 30-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.