DPCstruct | MC7469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 15.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8LP83 | 265-368 | YERQKYFLQIELLKAQQWIKESGQRVVLLFEGRDAAGKGGTIKRFTEHLNPRAAHVVALEKPSEREIGEWYFQRYIQKLPTRGEMVF… |
| A0A1D8FVZ8 | 51-156 | IRRAAYERRKRVLQIEMLKLQRWVRETGQRLVVICEGRDAAGKGGTIQRFTERLNPRGARVVALDKPTEKEAGQWYFQRYVAHLPSA… |
| A0A7X0G4G7 | 7-112 | None |
| A0A261D7N6 | 6-94 | None |
| A0A378C201 | 12-111 | None |
| A0A1B8Q5E0 | 32-148 | None |
| K6W669 | 3-107 | None |
| A0A7J0D3F9 | 42-123 | None |
| A0A7R9T9C7 | 162-291 | None |
| B1M888 | 36-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.