DPCstruct | MC7467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 284 ± 52 aa |
| Standard deviation of domain lengths | 51.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.43 |
| Pfam Score | 67.66 |
| Assigned Pfam label(s) | CL0748- CL0413- PF08278- PF10410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5J7D8 | 50-328 | YALHRAKEAIAGKGFVFVVEGYKDAIAMHVAGFSNTVALCGTALTAGQIALLKKYTNRICLLLDGDKPGREAARKISLSLNPYSMEV… |
| A0A832N8K6 | 22-299 | LTPSHLRLLRRWTSRIVLCFDADSAGMRAMIRALPLLEEEGMEARVVPLPQGQDPDSLLRAEGRKAFLERLSKAPLLVEHQIWHHLH… |
| A0A6L7YGB6 | 4-248 | None |
| A0A357NJC3 | 102-313 | None |
| A0A3D5A5H1 | 1-284 | None |
| A0A1A9VKA8 | 182-496 | None |
| A0A7V8SY78 | 125-424 | None |
| A0A1G1MNG9 | 2-193 | None |
| A0A094WDH4 | 136-391 | None |
| A0A1V5FRX0 | 4-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.