DPCstruct | MC7465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553K048 | 394-459 | PLGYTGSWSAADGRRWRTECDTAITGSDASRSYTWSSHISSVQQADGTWRHFPDEGWVMNNMVRFR |
| A0A1Q2CE66 | 10-76 | PLGHTGQWTAADGSKWRTECDTPATGGNGCRTYRWTTVYNAVRSEKGGGYDFTQENKWVVNNIVMFK |
| A0A1Q2CX77 | 28-103 | None |
| A0A1Q2CXP1 | 77-163 | None |
| A0A1Q2CZ73 | 271-350 | None |
| A0A1Q2D216 | 4-59 | None |
| A0A1M6CMF7 | 493-556 | None |
| A0A553JX18 | 383-450 | None |
| A0A553JX66 | 52-116 | None |
| A0A553K1S8 | 102-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.