DPCstruct | MC7461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0RKG4 | 499-605 | SVRLADFLKALIGEESELKLDMDGDQQTRLLKEGRIFWNHFTHISYTPHPAHFLKFLYRGLAVQCKPDQRGFNQMFPIYLAPELSEF… |
| A0A2N5UXP8 | 1-100 | MDLGNMEDSHKARLLTQDRIFWNHFKEITYMPDSVYLLRFLYRGLAILCKPNERGFDQMFPIYLEPEASDSILNEDHITFCGVQSKN… |
| A0A2S4WA18 | 78-207 | None |
| A0A180GIX1 | 636-768 | None |
| A0A180G0T4 | 117-247 | None |
| A0A2N5W1B2 | 205-315 | None |
| A0A2N5VYJ1 | 88-198 | None |
| A0A2S4UMV4 | 84-173 | None |
| A0A2N5VQM4 | 1-149 | None |
| A0A2S4WA44 | 414-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.