DPCstruct | MC746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8RUW2 | 1-78 | MAETAKGGPFTEIVESDIFINCIYLTSKIPSFVDEESLKSPNRKLSVVCDVSCDTTNPNNPIPIYNVNTVCTSTFIYS |
| A0A7S1SH85 | 75-161 | TIDWDMEETKAGGPFPAILDADIFVNCILLSGRTAPFLTSELIREHPQRKLSVISDVSCDPNSEYNPIPVYDRITSWEAPTLELEAA |
| A0A135S1R0 | 497-576 | None |
| A0A094FIE2 | 216-298 | None |
| A0A7S4UK19 | 350-433 | None |
| A0A2P6N1D9 | 457-539 | None |
| A0A093Y9F8 | 595-677 | None |
| A0A7S4PLI4 | 555-623 | None |
| A0A060SJJ9 | 52-136 | None |
| A0A430M3U5 | 183-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.