DPCstruct | MC7459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180G7G0 | 96-244 | NGLRSWVGIIANCYLLWQMAKESRSKTRAGDLGRELGIKDSINRQISMYKYDIRAKGDEATPANTAFITRIDMLDKDDPERLFNSFF… |
| A0A2N5UQM3 | 1-136 | MPTRSWQSSIKNTNELWLSSQIDTRKEFEKKAQEFGLKDHIAWKLMELKRDHLEDRTRIIKLEKDAPDRLYNPFIHLKSFDGSQDAP… |
| A0A2S4V2I0 | 357-490 | None |
| A0A2S4WG56 | 3-145 | None |
| A0A2S4W973 | 2-153 | None |
| A0A2N5S375 | 108-265 | None |
| H6QV93 | 14-172 | None |
| A0A5B0REF6 | 2-145 | None |
| A0A0L0W325 | 6-155 | None |
| A0A0C4EWJ3 | 2-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.