DPCstruct | MC7458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 248 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0314- PF18314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316ZBY4 | 362-626 | VGGKMPGGFNLATAKAHLNRTWGLGPGRTDAVLLVALTQEPAKRLGAEGDAKAFLDTAAQQYAQNAGITLSSGGGGGGGGGGGGGST… |
| A0A2N5UNQ9 | 31-283 | LAANLPYNPALCSLHVLEESPKPTNLRVALKLLMALTMETAKRLGSQAEAKSYLDSVVQTYGKHSDITLSQGGAAGAAGGSAGGAMI… |
| A0A1Y1WKL4 | 152-388 | None |
| A0A177TRZ6 | 153-386 | None |
| S0DL59 | 231-474 | None |
| A0A5C2SWD1 | 138-363 | None |
| A0A2N5VNP0 | 1-219 | None |
| Q5B7V0 | 234-483 | None |
| Q00681 | 149-381 | None |
| A0A0J8R3H8 | 249-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.