DPCstruct | MC7456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 162 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180H239 | 2-153 | LQSWSSLTAAADKCRDVFQQGASMEVALQAASSFSYQAVAVNRQAGRCACDSSAFDVSAQFKAQIVHLFSSLQVTLKLGAERYGSDW… |
| A0A2N5UBY7 | 5-180 | VSGWSALPNAFNKCQLALESHPPINVALQAIFSLQVTVQLTISTYGSCTTCSTLSPNSELALRFKTIITQIFTSWQNFVHLGQNNYG… |
| A0A2S4WBE6 | 54-209 | None |
| A0A0L6VNN4 | 53-217 | None |
| A0A2N5VTK6 | 100-242 | None |
| A0A2S4VDD8 | 237-394 | None |
| Q9Y8A0 | 2-163 | None |
| A0A0L6U7W4 | 36-208 | None |
| A0A2N5UFI0 | 19-175 | None |
| A0A2N5UFG6 | 59-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.