DPCstruct | MC7455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 179 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KT44 | 140-314 | IQMWINQLEKDKDVISQSQAIAVLEKLPQLSFAVINALNNFLNDTKAFWRVRVEAAYALAVTASEETDLAGLLHLVKFYKSRRFDTD… |
| A0A2N5U7K2 | 1-186 | MKEFMWLEQLQRDRDVVAQLEAVRALKTLPTKVVSSHLCRVVLISEYYFRIRVEAVLALVSTRYCYPPQVEPDSPWNIRAIPKPNQF… |
| A0A1I8FDL1 | 307-465 | None |
| A0A2P2MHN2 | 211-400 | None |
| A0A836DB55 | 457-640 | None |
| A0A0V0Y2J9 | 162-331 | None |
| A0A0D8YDS2 | 7-169 | None |
| A0A420YKQ8 | 405-609 | None |
| A0A167EIT4 | 376-558 | None |
| A0A0B1SP53 | 235-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.