DPCstruct | MC7453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 448 ± 93 aa |
| Standard deviation of domain lengths | 93.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X3P4S1 | 9-425 | GATDTERLAAALPLLDTTAQLTIILGNAFAAADVRHIDTNQLADQINSLDDQAKQIRPRLNSRERLLNIDGDKESGSMITDPLSGLV… |
| C8W274 | 11-424 | SILEWLEYWFSTRKNIIDLFQKSVACICKQLEEKPLGSLATEIDSLRIEMNKKLIKEFRFPYKDRPFDEKAKIPEGFSKIKSDYFQS… |
| A8ZNI6 | 192-619 | None |
| A0A4R2JHC9 | 2-384 | None |
| A0A369LC73 | 1-342 | None |
| A0A096CH14 | 16-369 | None |
| A0A8A9F1U3 | 241-910 | None |
| U2BT61 | 91-623 | None |
| A0A3N2M910 | 723-1242 | None |
| A0A0B1Z2L1 | 1-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.