DPCstruct | MC7452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844RTH9 | 2-109 | EVQSEFRQVFLPYCLIKTADGAYVVVNRRYKPVGIVLTDWVNYDKYPVKVRFKKALSKAQIAALDYAGRTDDTRIYLYNDACVPTSS… |
| A0A2M7EZV7 | 81-182 | MDPMQAIFPYGMEMDDDGLWTFFNRSYKPVGMNTNEFIDYKDHPVRFKLKGLGPATRDKLDVRGKGTDRQIFFYDDATRPTISADTM… |
| A0A6L8ASW4 | 115-225 | None |
| A0A5C7T3V5 | 59-163 | None |
| A0A3S0RXJ5 | 6-107 | None |
| A0A4R0QLI2 | 1-91 | None |
| A0A0Q6ZK90 | 12-122 | None |
| A0A6P2FTG2 | 139-228 | None |
| A0A091B6J6 | 34-128 | None |
| A0A2S9WXB7 | 6-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.