DPCstruct | MC7451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 206 ± 52 aa |
| Standard deviation of domain lengths | 52.44 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7EXQ8 | 1-218 | MACDPRPWHEQKRAAAFAGVAAVFLVNVFVTPSNALLVAVTNDAIATVNPNAAISDVGNLFFMIGSSILMAIVVTILIERFVEPRLG… |
| A0A7C2NJE7 | 411-680 | AQGLRFAVTSLVDNFKNFPPLAIVLVGMLGIGLADRTGFLGALLKAALLAMPARLLTPALLLVGICSSVALDAGYVVLPPIAAALFA… |
| A0A8B4PEJ5 | 105-263 | None |
| A0A1C5SPC8 | 177-352 | None |
| A0A485CJ71 | 33-187 | None |
| A0A0G3HBD9 | 335-616 | None |
| T0CWU4 | 1-324 | None |
| W4PB99 | 41-305 | None |
| W7YYV2 | 12-204 | None |
| A0A812IR89 | 472-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.