DPCstruct | MC745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 90 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 95.18 |
| Assigned Pfam label(s) | CL0010- PF05712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2U8Q0 | 185-254 | HLFPLHEKVYVDVKRILYEATILKYRCQENRNEYRVHFKGFKKRQNIWTDESMIHTIQKTSTQKFLKQRE |
| A0A0J8RUM2 | 4-87 | QKQMYQKDEVVLCFHHDILYDAKILDSRLESPEDKNSLYEYRVHYKGWKHTWDDWVSQDRLRKYTEENKELASTLRRQAEAAMR |
| A0A2H0ZAQ3 | 319-371 | None |
| A0A521V6V2 | 153-224 | None |
| R7QSP1 | 51-150 | None |
| A0A7S2XTT2 | 736-823 | None |
| A0A4Y7L6C4 | 119-210 | None |
| A0A1D1WBC5 | 14-113 | None |
| A0A7R9PYP1 | 152-234 | None |
| A0A1X7PRR7 | 147-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.