DPCstruct | MC7447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 218 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834KJX7 | 146-369 | YIMTFEVIKLKKHMNIELRTSKRSKDPSKIAAKLFSALWIYLNKSKEHIFKVLLRIKLITKRYAKICDLIFSKSFTNLKTNGESMTG… |
| A0A182PB72 | 29-233 | DILADYIRFRCESVTGLDPPAEPAILLRECNRIVGSMFVIFDGSVELMTLTLLSTSASRQHALLLYPVFENVLTAGMGRPDYDTVPG… |
| A0A833SIX4 | 66-278 | None |
| A0A182WAM0 | 49-242 | None |
| A0A154PLN6 | 121-307 | None |
| Q16QQ6 | 1-201 | None |
| E9J3N0 | 8-249 | None |
| A0A182GWC0 | 1-202 | None |
| A0A182PB71 | 25-263 | None |
| A0A6E8WDF5 | 10-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.