DPCstruct | MC7446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 449 ± 28 aa |
| Standard deviation of domain lengths | 27.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G6WXD1 | 225-646 | ASALLKLNKSIYPDQHLSIHWQDLYSLSELDEELTELWCGDRSSNDYWKAQMISARGAEKLVSRFYKGQGYSVEDLAIHQITNQSTA… |
| A0A6H2BZB7 | 705-1155 | PTGKKQEIVQQRVKTFFDIISRFEDSNYPYEEYITHNWRELYQFNQSDNSLIREWDADVNFNDNKAAQMISARGAEKLVIRFYQALG… |
| A0A7Y5F1T8 | 171-665 | None |
| A0A7U3GH87 | 317-773 | None |
| A0A1G7ARK2 | 2-466 | None |
| A0A3G6WX01 | 240-670 | None |
| A0A846CB44 | 17-498 | None |
| A0A1L7ANC5 | 165-600 | None |
| A0A2S9NKC2 | 274-668 | None |
| A0A1V6IYP3 | 179-631 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.