DPCstruct | MC7445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 716 |
|---|---|
| Mean domain length (aa) | 198 ± 38 aa |
| Standard deviation of domain lengths | 38.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 12.17 |
| Pfam Score | 71.30 |
| Assigned Pfam label(s) | CL0047- CL0126- CL0071- CL0285- CL0490 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831TUB2 | 33-229 | ASEAAAIDRETGILISYLRLGDMSLPRPRGDPPAVSQEEALRRAREFLERVGVEPRAPWVLTEARYQDAGTIAFYTFLWRKYFHGLR… |
| A0A534T0E8 | 1-128 | MSLKQGIVASAPKGKPISGKFEVEDGKLQLSVYTAKGGGFSEVVVDPRSGRVAKVEAIEGGEDLTAAKAQADAMTKAKTALGGAVDA… |
| A0A6N3F9B0 | 12-189 | None |
| A0A318KQH4 | 8-229 | None |
| W7ZJU5 | 12-185 | None |
| W7ZST3 | 430-594 | None |
| A0A1E7DTL9 | 59-241 | None |
| A0A518AN43 | 14-208 | None |
| A0A2R3MYW8 | 291-494 | None |
| A0A099T2Q7 | 1-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.