DPCstruct | MC7444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7RD71 | 62-209 | PEAKRVVTPELLASATRGWLCYEGQGFDSSAKSYPSTGVLNGIDIGLLSSAGGSETANIWSEEQRVPIPAEALRSIGAHNIFSLRNP… |
| A0A7Y5UY68 | 13-160 | AAGYHFAPPGGIADSDLARATAVRVRLQIFDSNGEAPFAGKRILLNGRDVAGVPASPANRFHDWHEVILELTPEQAGAIGRTNTIEI… |
| A0A7X7BBX7 | 37-187 | None |
| A0A388QRQ2 | 266-399 | None |
| A0A7X7FHP9 | 670-802 | None |
| A0A1G1C4U9 | 2-120 | None |
| A0A7X7QY81 | 899-1031 | None |
| A0A1G3ZQQ1 | 102-250 | None |
| A0A1G3PSN7 | 62-195 | None |
| A0A7C7LJ17 | 228-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.