DPCstruct | MC7440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8IYG0 | 1-79 | MIMVDELRRYRSGSWCHLTTDGDIEELHVFAQRIGLKREWFQNVRVPHYDLRPSLRRKALAAGARFVSAREQARARVAQ |
| A0A2T5WYF0 | 1-83 | MVYVDDMKAWFGRMIMCHMIADTEAELHEMAGRIGIAHRWYQGDHYDISLSRRALAVAAGAAEITLRQCGVMVMRRRATGSLG |
| A0A2G6DWJ9 | 1-83 | None |
| A0A4S8HJ13 | 1-72 | None |
| A0A1F2X1X0 | 1-69 | None |
| A0A841AGS2 | 1-85 | None |
| A0A838UUY6 | 1-99 | None |
| A0A1H1ZT68 | 1-92 | None |
| A0A2U1SZ73 | 89-171 | None |
| A0A5J4KZC0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.