DPCstruct | MC744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7RBC8 | 25-87 | MKDFKSQCIDTPGVIKRVSRLFRGRPSLIIGFNTFLPPGFDVCVDGPKIIISEPNGRQHIVDE |
| A0A0J8RPZ7 | 1-90 | MKDFKSQAIDTPGVIQRVSTLFNGHPTLIQGFNTFLPPGYRIECGPDDNPDAIRVTTPSGTNTISMSAGRPALEATTEPWDKGGGLI… |
| A0A2I0TGM3 | 440-507 | None |
| A0A6A4H2P5 | 52-116 | None |
| A0A836AKE9 | 45-153 | None |
| A0A2W1B756 | 149-233 | None |
| A0A674K5I2 | 40-120 | None |
| I1C6H8 | 48-132 | None |
| A0A178Z320 | 87-151 | None |
| M5BUG8 | 36-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.