DPCstruct | MC7438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0BS92 | 10-123 | ISLVMTVVRSLLLFVLAAVAEIGGAWLVWQGVREQRGLVWIGAGIVALGLYGFVATLQPDAHFGRILAAYGGVFVAGSLAWGMVFDG… |
| A0A5M8ABZ9 | 7-120 | LPASIVTFLAYTALFVLTALAEIVGCYLPYLVLKQEKTPLLLVPAALALAAFAWLLTLHPTAAGRTYAAYGGVYIAVALVWLRIVDG… |
| A0A5K1A5I1 | 45-163 | None |
| A0A7S1GMH0 | 56-188 | None |
| A0A1Y5IJG1 | 469-589 | None |
| D5ADJ3 | 6-116 | None |
| A0A1H7C6K5 | 2-113 | None |
| A0A2Z5YWC3 | 231-344 | None |
| A9T501 | 5-119 | None |
| K9Q7H5 | 27-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.