DPCstruct | MC7437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0081 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0W3M2 | 39-201 | EWLPKGWVMEIRAAGEKTDKMYKFYVHSITGVRLLSKQDVLLYINEANVSGCNTNGQCDTSSEDNILAKVDFRPSGLPEGWIKEIVY… |
| A0A1S3AYW3 | 8-180 | DLLPPGWTVKVKVRKSGKKDKYYFEPSSQMRFNSRAEVFRYLKTAAICHPESEESRTIKEPGNNVCQKNLPSTYNVEVKKTIAKDLP… |
| A0A1E5WKZ0 | 27-243 | None |
| J3LWE4 | 70-286 | None |
| K7LMQ4 | 4-158 | None |
| A0A2H5NDA0 | 16-259 | None |
| A0A6P6AJE7 | 4-172 | None |
| A0A0A9NG96 | 8-206 | None |
| A0A2J6M2X8 | 4-213 | None |
| C0HE81 | 38-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.